PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_27787.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 63aa    MW: 7593.74 Da    PI: 6.2385
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_27787.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM64.82.6e-201763148
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             lppGfrFhPtdeel+++yLk+k++g+++el e+i+evd+yk+ePwdLp
  Rsa1.0_27787.1_g00001.1 17 LPPGFRFHPTDEELITYYLKRKINGREIEL-EIIPEVDLYKWEPWDLP 63
                             79****************************.99**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-21863IPR003441NAC domain
PROSITE profilePS5100523.2871763IPR003441NAC domain
PfamPF023651.3E-91860IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
GSQFHRHPRI FMAAVSLPPG FRFHPTDEEL ITYYLKRKIN GREIELEIIP EVDLYKWEPW  60
DLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-17663461Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052389e-55AB005238.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKP11.
GenBankCP0026889e-55CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626927.11e-28PREDICTED: NAC domain-containing protein 86-like isoform X1
RefseqXP_013626928.11e-28PREDICTED: NAC domain-containing protein 86-like isoform X2
RefseqXP_013680578.11e-28PREDICTED: NAC domain-containing protein 86-like isoform X1
RefseqXP_013680579.11e-28PREDICTED: NAC domain-containing protein 86-like isoform X2
SwissprotQ9FFI52e-28NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A078C1F21e-28A0A078C1F2_BRANA; BnaC03g08290D protein
TrEMBLA0A0D3B1L32e-28A0A0D3B1L3_BRAOL; Uncharacterized protein
STRINGGLYMA11G33210.13e-27(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.11e-29NAC domain containing protein 86